.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vkc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Putative acetyl transferase from Pyrococcus furiosus. To be published
    Site SECSG
    PDB Id 1vkc Target Id Pfu-35386-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9364, Molecular Weight 17782.48 Da.
    Residues 150 Isoelectric Point 5.06
    Sequence meytivdgeeyieeikkldreisysfvrfpisyeeyeerheelfesllsqgehkffvalnersellghv wicitldtvdyvkiayiydievvkwarglgigsallrkaeewakergakkivlrveidnpavkwyeerg ykaralimekpi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.89 Rfree 0.24419
    Matthews' coefficent 2.09 Rfactor 0.20726
    Waters 54 Solvent Content 41.01

    Ligand Information
    Ligands
    Metals IOD (IODIDE) x 13

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch