| Title | Putative acetyl transferase from Pyrococcus furiosus. To be published | | Site | SECSG | | PDB Id | | Target Id | Pfu-35386-001 | | Molecular Characteristics | | Source | Pyrococcus furiosus | | Alias Ids | TPS9364, | Molecular Weight | 17782.48 Da. | | Residues | 150 | Isoelectric Point | 5.06 | | Sequence | meytivdgeeyieeikkldreisysfvrfpisyeeyeerheelfesllsqgehkffvalnersellghv wicitldtvdyvkiayiydievvkwarglgigsallrkaeewakergakkivlrveidnpavkwyeerg ykaralimekpi | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.89 | Rfree | 0.24419 | | Matthews' coefficent | 2.09 | Rfactor | 0.20726 | | Waters | 54 | Solvent Content | 41.01 |
| Ligand Information | | Ligands | | | Metals | IOD (IODIDE) x 13 | | |
