| Title | Inorganic pyrophosphatase from Pyrococcus furiosus Pfu-264096-001. To be published | | Site | SECSG | | PDB Id | | Target Id | Pfu-264096-001 | | Molecular Characteristics | | Source | Pyrococcus furiosus | | Alias Ids | TPS9329, | Molecular Weight | 20912.07 Da. | | Residues | 178 | Isoelectric Point | 4.91 | | Sequence | mnpfhdlepgpdvpevvyaiieipkgsrnkyeldkktgllkldrvlyspffypvdygiiprtwyedddp fdimvimrepvypltiiearpiglfkmidsgdkdykvlavpvedpyfkdwkdiddvpkafldeiahffk rykelqgkeiivegwegaeaakreilraiemykekfgkke | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.20 | Rfree | 0.2574 | | Matthews' coefficent | 2.08 | Rfactor | 0.1936 | | Waters | 35 | Solvent Content | 40.73 |
| Ligand Information | | Ligands | | | Metals | | | |
