| Title | Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function. To be Published | | Site | SECSG | | PDB Id | | Target Id | R12E2.13 | | Molecular Characteristics | | Source | Caenorhabditis elegans | | Alias Ids | TPS9280, | Molecular Weight | 22785.27 Da. | | Residues | 206 | Isoelectric Point | 6.24 | | Sequence | mpklplllsfpllffasfayadedfvtcysvlkfinandgsrlhshdvkygsgsgqqsvtavknsddin shwqifpalnakcnrgdaikcgdkirlkhlttgtflhshhftaplskqhqevsafgseaesdtgddwtv icngdewleseqfklrhavtgsylslsgqqfgrpihgqrevvgtdsitggsawkvaegiyikhqqkdl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.00 | Rfree | 0.267 | | Matthews' coefficent | 2.30 | Rfactor | 0.217 | | Waters | 130 | Solvent Content | 46.00 |
| Ligand Information | | Ligands | MLI (MALONATE) x 1 | | Metals | | | |
