| Title | Crystal Structure of Glucose Dehydrogenase of Caenorhabditis Elegans in the Apo-Form: A Member of the SDR-Family. To be Published | | Site | SECSG | | PDB Id | | Target Id | D1054.8 | | Molecular Characteristics | | Source | Caenorhabditis elegans | | Alias Ids | TPS9296, | Molecular Weight | 29365.77 Da. | | Residues | 278 | Isoelectric Point | 6.38 | | Sequence | mtrfaekvaiitgssngigratavlfaregakvtitgrhaerleetrqqilaagvseqnvnsvvadvtt dagqdeilsttlgkfgkldilvnnagaaipdsqsktgtaqsiesydatlnlnlrsvialtkkavphlss tkgeivnissiasglhatpdfpyysiakaaidqytrntaidliqhgirvnsispglvatgfgsamgmpe etskkfystmatmkecvpagvmgqpqdiaeviafladrktssyiighqlvvdggsslimglhcqdfakllh | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.10 | Rfree | 0.25 | | Matthews' coefficent | 3.17 | Rfactor | 0.202 | | Waters | 145 | Solvent Content | 60.90 |
| Ligand Information | | Ligands | | | Metals | | | |
