| Title | All three Ca2+-binding loops of photoproteins bind calcium ions: The crystal structures of calcium-loaded apo-aequorin and apo-obelin. Protein Sci. 14 663-675 2005 | | Site | SECSG | | PDB Id | | Target Id | Aae-Aeq | | Molecular Characteristics | | Source | Aequorea aequorea | | Alias Ids | TPS9314, | Molecular Weight | 22513.06 Da. | | Residues | 196 | Isoelectric Point | 4.78 | | Sequence | mtseqysvkltpdfdnpkwigrhkhmfnfldvnhngrisldemvykasdivinnlgatpeqakrhkdav eaffggagmkygvetewpeyiegwkrlaseelkrysknqitlirlwgdalfdiidkdqngaisldewka ytksdgiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpaceklyggavp | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.70 | Rfree | 0.23635 | | Matthews' coefficent | 2.28 | Rfactor | 0.21573 | | Waters | 154 | Solvent Content | 46.07 |
| Ligand Information | | Ligands | | | Metals | CA (CALCIUM) x 3 | | |
