| Title | All three Ca2+-binding loops of photoproteins bind calcium ions: The crystal structures of calcium-loaded apo-aequorin and apo-obelin. Protein Sci. 14 663-675 2005 | | Site | SECSG | | PDB Id | | Target Id | Oob-Ca_H_Obelin | | Molecular Characteristics | | Source | Obelia longissima | | Alias Ids | TPS9362, | Molecular Weight | 22224.74 Da. | | Residues | 195 | Isoelectric Point | 4.89 | | Sequence | msskyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhqvcve affrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfdifdkdgsgtitldewkay gkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpeadglygngvp | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.20 | Rfree | 0.23938 | | Matthews' coefficent | 2.13 | Rfactor | 0.18584 | | Waters | 110 | Solvent Content | 42.30 |
| Ligand Information | | Ligands | | | Metals | CA (CALCIUM) x 3 | | |
