| Title | Conserved hypothetical protein from Pyrococcus furiosus Pfu-871755-001. To be Published | | Site | SECSG | | PDB Id | | Target Id | Pfu-871755-001 | | Molecular Characteristics | | Source | Pyrococcus furiosus | | Alias Ids | TPS9300, | Molecular Weight | 10642.88 Da. | | Residues | 95 | Isoelectric Point | 5.01 | | Sequence | mstrgdlirilgeieekmnelkmdgfnpdiilfgreaynflsnllkkemeeegpfthvsnikieileel ggdavvidskvlglvpgaakrikiik | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.85 | Rfree | 0.22955 | | Matthews' coefficent | 2.32 | Rfactor | 0.2101 | | Waters | 39 | Solvent Content | 46.99 |
| Ligand Information | | Ligands | | | Metals | AU (GOLD) x 1 | | |