| Title | Backbone solution structures of proteins using residual dipolar couplings: Application to a novel structural genomics target. J.STRUCT.FUNCT.GENOM. 5 241-254 2005 | | Site | SECSG | | PDB Id | | Target Id | Pfu-1016054-001 | | Molecular Characteristics | | Source | Pyrococcus furiosus | | Alias Ids | TPS9369, | Molecular Weight | 7685.62 Da. | | Residues | 69 | Isoelectric Point | 5.40 | | Sequence | mkmikvkvigrniekeiewregmkvrdilravgfntesaiakvngkvvleddevkdgdfvevipvvsgg | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
