| Title | Endoplasmic reticulum protein Rp19. To be Published | | Site | SECSG | | PDB Id | | Target Id | O95881 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS9352, | Molecular Weight | 19204.76 Da. | | Residues | 172 | Isoelectric Point | 5.25 | | Sequence | metrprlgatcllgfsflllvissdghnglgkgfgdhihwrtledgkkeaaasglplmviihkswcgac kalkpkfaesteiselshnfvmvnledeeepkdedfspdggyiprilfldpsgkvhpeiinengnpsyk yfyvsaeqvvqgmkeaqerltgdafrkkhledel | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.20 | Rfree | 0.1835 | | Matthews' coefficent | 2.01 | Rfactor | 0.1616 | | Waters | 97 | Solvent Content | 38.74 |
| Ligand Information | | Ligands | | | Metals | PT (PLATINUM) x 2;CL (CHLORIDE) x 3 | | |
