| Title | Crystal structure of a Ca2+-discharged photoprotein: implications for mechanisms of the calcium trigger and bioluminescence. J.Biol.Chem. 279 33647-33652 2004 | | Site | SECSG | | PDB Id | | Target Id | Oob-Ca_W92F_Obelin | | Molecular Characteristics | | Source | Obelia longissima | | Alias Ids | TPS9357, | Molecular Weight | 22185.70 Da. | | Residues | 195 | Isoelectric Point | 4.89 | | Sequence | msskyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhqvcve affrgcgmeygkeiafpqfldgfkqlatselkkwarneptlirewgdavfdifdkdgsgtitldewkay gkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpeadglygngvp | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.96 | Rfree | 0.25922 | | Matthews' coefficent | 2.31 | Rfactor | 0.22278 | | Waters | 145 | Solvent Content | 46.86 |
| Ligand Information | | Ligands | CEI (N-[3-BENZYL-5-(4-HYDROXYPHENYL)PYRAZIN-2-YL]-2-(4-) x 1;GOL (GLYCEROL) x 1 | | Metals | NA (SODIUM) x 1;CL (CHLORIDE) x 1 | | |
