| Title | A Dipolar Coupling Based Strategy for Simultaneous Resonance Assignment and Structure Determination of Protein Backbones. J.Am.Chem.Soc. 123 11791-11796 2001 | | Site | SECSG | | PDB Id | | Target Id | Pfu-1210573-001 | | Molecular Characteristics | | Source | Pyrococcus furiosus | | Alias Ids | TPS9303, | Molecular Weight | 6026.41 Da. | | Residues | 54 | Isoelectric Point | 4.12 | | Sequence | makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
