| Title | The hyperthermophile protein Sso10a is a dimer of winged helix DNA-binding domains linked by an antiparallel coiled coil rod. J.Mol.Biol. 341 73-91 2004 | | Site | SECSG | | PDB Id | | Target Id | Sso-10a | | Molecular Characteristics | | Source | Sulfolobus solfataricus | | Alias Ids | TPS9311, | Molecular Weight | 11241.79 Da. | | Residues | 96 | Isoelectric Point | 9.75 | | Sequence | makkrskleiiqaileacksgspktrimyganlsyaltgryikmlmdleiirqegkqymltkkgeelle dirkfnemrknmdqlkekinsvlsirq | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.47 | Rfree | 0.244 | | Matthews' coefficent | 2.86 | Rfactor | 0.232 | | Waters | 175 | Solvent Content | 56.94 |
| Ligand Information | | Ligands | | | Metals | | | |
