.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r7j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title The hyperthermophile protein Sso10a is a dimer of winged helix DNA-binding domains linked by an antiparallel coiled coil rod. J.Mol.Biol. 341 73-91 2004
    Site SECSG
    PDB Id 1r7j Target Id Sso-10a
    Molecular Characteristics
    Source Sulfolobus solfataricus
    Alias Ids TPS9311, Molecular Weight 11241.79 Da.
    Residues 96 Isoelectric Point 9.75
    Sequence makkrskleiiqaileacksgspktrimyganlsyaltgryikmlmdleiirqegkqymltkkgeelle dirkfnemrknmdqlkekinsvlsirq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.47 Rfree 0.244
    Matthews' coefficent 2.86 Rfactor 0.232
    Waters 175 Solvent Content 56.94

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch