| Title | Crystal structures of two UBC (E2) enzymes of the ubiquitin-conjugating system in Caenorhabditis elegans. To be Published | | Site | SECSG | | PDB Id | | Target Id | C35B1.1 | | Molecular Characteristics | | Source | Caenorhabditis elegans | | Alias Ids | TPS9279, | Molecular Weight | 21511.58 Da. | | Residues | 192 | Isoelectric Point | 4.30 | | Sequence | mttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklslefteeypnkppt vkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpnspanslaaqlyqenrreye krvqqiveqswlnfgenegdavlkddveieeiaapgandadddrmdegasgsna | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 3 | | Resolution (Å) | 2.90 | Rfree | 0.266 | | Matthews' coefficent | 3.12 | Rfactor | 0.233 | | Waters | 61 | Solvent Content | 60.64 |
| Ligand Information | | Ligands | | | Metals | | | |
