| Title | Crystal structures of two UBC (E2) enzymes of the ubiquitin-conjugating system in Caenorhabditis elegans. To be Published | | Site | SECSG | | PDB Id | | Target Id | F58A4.10 | | Molecular Characteristics | | Source | Caenorhabditis elegans | | Alias Ids | TPS9278, | Molecular Weight | 18937.65 Da. | | Residues | 164 | Isoelectric Point | 5.06 | | Sequence | meqsslllkkqladmrrvpvdgfsaglvddndiykwevlvigppdtlyeggffkaildfprdypqkppk mkfiseiwhpnidkegnvcisilhdpgddkwgyerpeerwlpvhtvetillsvismltdpnfespanvd aakmqrenyaefkkkvaqcvrrsqee | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.52 | Rfree | 0.289 | | Matthews' coefficent | 2.30 | Rfactor | 0.241 | | Waters | 41 | Solvent Content | 46.42 |
| Ligand Information | | Ligands | | | Metals | | | |
