| Title | Structural genomics of caenorhabditis elegans: crystal structure of calmodulin. Proteins 53 947-949 2003 | | Site | SECSG | | PDB Id | | Target Id | T21H3.3 | | Molecular Characteristics | | Source | Caenorhabditis elegans | | Alias Ids | TPS9276, | Molecular Weight | 16823.73 Da. | | Residues | 149 | Isoelectric Point | 4.09 | | Sequence | madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtidfpef ltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevdemireadidgdgqvn yeefvtmmttk | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.11 | Rfree | 0.271 | | Matthews' coefficent | 2.07 | Rfactor | 0.212 | | Waters | 91 | Solvent Content | 40.05 |
| Ligand Information | | Ligands | | | Metals | CA (CALCIUM) x 4 | | |
