| Title | Southeast Collaboratory for Structural Genomics: hypothetical protein from Pyrococcus furiosus Pfu-1218608. To be published | | Site | SECSG | | PDB Id | | Target Id | Pfu-1218608-001 | | Molecular Characteristics | | Source | Pyrococcus furiosus | | Alias Ids | TPS9305, | Molecular Weight | 28490.59 Da. | | Residues | 252 | Isoelectric Point | 5.41 | | Sequence | mvyvavlaniagnlpaltaalsrieemreegyeiekyyilgnivglfpypkevievikdltkkenvkii rgkydqiiamsdphatdpgyidklelpghvkkalkftweklghegreylrdlpiylvdkiggnevfgvy gspinpfdgevlaeqptsyyeaimrpvkdyemlivaspmypvdamtrygrvvcpgsvgfppgkehkatf alvdvdtlkpkfieveydkkiieeriraeglpeeiikilyhggrp | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.90 | Rfree | 0.23498 | | Matthews' coefficent | 2.94 | Rfactor | 0.21592 | | Waters | 106 | Solvent Content | 57.79 |
| Ligand Information | | Ligands | | | Metals | NA (SODIUM) x 2;PT (PLATINUM) x 4 | | |
