| Title | Structural basis for the substrate specificity of the feruloyl esterase domain of the cellulosomal xylanase Z from Clostridium thermocellum. Biochemistry 40 12524-12532 2001 | | Site | SECSG | | PDB Id | | Target Id | Cth-FAEZ | | Molecular Characteristics | | Source | Clostridium thermocellum | | Alias Ids | TPS9306, | Molecular Weight | 29037.10 Da. | | Residues | 268 | Isoelectric Point | 6.58 | | Sequence | lvtisstsaaslptmppsgydqvrngvprgqvvnisyfstatnstrparvylppgyskdkkysvlyllh giggsendwfegggranviadnliaegkikpliivtpntnaagpgiadgyenftkdllnslipyiesny svytdrehraiaglsmgggqsfnigltnldkfayigpisaapntypnerlfpdggkaareklkllfiac gtndsligfgqrvheycvanninhvywliqggghdfnvwkpglwnflqmadeagltrdgnt | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.75 | Rfree | 0.206 | | Matthews' coefficent | 1.90 | Rfactor | 0.189 | | Waters | 281 | Solvent Content | 35.00 |
| Ligand Information | | Ligands | | | Metals | PT (PLATINUM) x 1 | | |
