The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P. Nat.Struct.Mol.Biol. 2010
    Site RSGI
    PDB Id 3a5z Target Id my_001000087.2
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS31854, Molecular Weight 36974.11 Da.
    Residues 325 Isoelectric Point 5.08
    Sequence msetaswqpsasipnllkraaimaeirrffadrgvlevetpcmsqatvtdihlvpfetrfvgpghsqgm nlwlmtspeyhmkrllvagcgpvfqlcrsfrneemgryhnpeftmlewyrphydmyrlmnevddllqqv ldcpaaeslsyqqaflryleidplsadktqlrevaakldlsnvadteedrdtllqllftfgvepnigke kptfvyhfpasqaslaqistedhrvaerfevyykgielangfheltdareqqqrfeqdnrkraarglpq hpidqnliealkvgmpdcsgvalgvdrlvmlalgaetlaeviafsvdra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.268
    Matthews' coefficent 2.77 Rfactor 0.226
    Waters 229 Solvent Content 55.63

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch