| Title | Crystal structure of uncharacterized conserved protein from Geobacillus kaustophilus. To be Published | | Site | RSGI | | PDB Id | | Target Id | gka001001155.2 | | Molecular Characteristics | | Source | Geobacillus kaustophilus | | Alias Ids | TPS12300, | Molecular Weight | 26943.44 Da. | | Residues | 246 | Isoelectric Point | 7.28 | | Sequence | ghmhtpfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfldlklhdipn tvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciavtqltstdermlheelwis rplvetvahyaalakesgldgvvcsaneaafikercgasflavtpgirfaddaahdqvrvvtprkaral gsdyivigrsltraadplrtyarlqhewnggeresttpt | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.20 | Rfree | 0.272 | | Matthews' coefficent | 2.02 | Rfactor | 0.214 | | Waters | 169 | Solvent Content | 39.07 |
| Ligand Information | | Ligands | C5P (CYTIDINE-5'-MONOPHOSPHATE) x 2 | | Metals | | | |
