.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yt1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode. J.Biol.Chem. 283 27165-27178 2008
    Site RSGI
    PDB Id 2yt1 Target Id tkr001324506.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS14069, Molecular Weight 19469.72 Da.
    Residues 178 Isoelectric Point 4.79
    Sequence daavtpeerhlskmqqngyenptykffeqmqnsgpssgiegrgssgssgssgssgptpktelvqkfrvq ylgmlpvdrpvgmdtlnsaienlmtssskedwpsvnmnvadatvtvisekneeevlvecrvrflsfmgv gkdvhtfafimdtgnqrfechvfwcepnaanvseavqaac
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch