| Title | Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode. J.Biol.Chem. 283 27165-27178 2008 | | Site | RSGI | | PDB Id | | Target Id | tkr001324506.1 | | Molecular Characteristics | | Source | Mus musculus | | Alias Ids | TPS14069, | Molecular Weight | 19469.72 Da. | | Residues | 178 | Isoelectric Point | 4.79 | | Sequence | daavtpeerhlskmqqngyenptykffeqmqnsgpssgiegrgssgssgssgssgptpktelvqkfrvq ylgmlpvdrpvgmdtlnsaienlmtssskedwpsvnmnvadatvtvisekneeevlvecrvrflsfmgv gkdvhtfafimdtgnqrfechvfwcepnaanvseavqaac | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
