| Title | Crystal structure of N-acetyl-gamma-glutamyl-phosphate reductase (TTHA1904) from Thermus thermophilus. To be Published | | Site | RSGI | | PDB Id | | Target Id | ttk003000050.1 | | Molecular Characteristics | | Source | Thermus thermophilus | | Alias Ids | TPS14206, | Molecular Weight | 38088.69 Da. | | Residues | 345 | Isoelectric Point | 8.71 | | Sequence | mtgkktlsivgasgyaggeflrlalshpylevkqvtsrrfagepvhfvhpnlrgrtnlkfvppeklepa dilvlalphgvfarefdrysalapvlvdlsadfrlkdpelyrryygehprpdllgrfvyavpelyreal kgadwiagagcnatatllglypllkagvlkptpifvtllistsaggaeaspashhperagsirvykptg hrhtaevvenlpgrpevhltaiatdrvrgilmtaqcfvqdgwserdvwqayreayagepfirlvkqkkg vhrypdprfvqgtnyadigfeleedtgrlvvmtaidnlvkgtaghalqalnvrmgwpetlgldfpglhp | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.01 | Rfree | 0.207 | | Matthews' coefficent | 3.37 | Rfactor | 0.185 | | Waters | 301 | Solvent Content | 63.50 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 2;AZI (AZIDE) x 7 | | Metals | | | |
