| Title | Crystal structure of geranylgeranyl pyrophosphate synthetase from Pyrococcus horikoshii Ot3. To be Published | | Site | RSGI | | PDB Id | | Target Id | pho001001072.1 | | Molecular Characteristics | | Source | Pyrococcus horikoshii | | Alias Ids | TPS13971, | Molecular Weight | 38549.58 Da. | | Residues | 342 | Isoelectric Point | 5.93 | | Sequence | mekyeelfarikekaklidekifelipekdprvlyeaarhyplaggkrvrpfvvltsteavggdplrai ypavaielihnyslvhddimdmdetrrgkptvhriwgvnmailagdllfskafeavaraeippekkarv levivkasnelcegqardlefekkstvtieeymemisgktgalfeasakvggiigtdneeyikalsswg rnvgiafqiwddvldliadekklgkpvgsdirkgkktlivahffenadekdkqrflkifgkyagdvkgr giieediksdvmeaidllkkygsidyaaeiakdmikkanealrilpkskarmdlellakfiverey | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.20 | Rfree | 0.263 | | Matthews' coefficent | 2.50 | Rfactor | 0.246 | | Waters | 177 | Solvent Content | 51.50 |
| Ligand Information | | Ligands | | | Metals | BR (BROMIDE) x 1;HG (MERCURY) x 1 | | |
