| Title | Crystal structure of geranulgeranyl diphosphate synthase from Thermus thermophilus. To be Published | | Site | RSGI | | PDB Id | | Target Id | ttk003000153.1 | | Molecular Characteristics | | Source | Thermus thermophilus | | Alias Ids | TPS14251, | Molecular Weight | 36500.94 Da. | | Residues | 330 | Isoelectric Point | 5.57 | | Sequence | mvpapeairqalqerllarldhpdplyrdllqdyprrggkmlrglltvysalahgapleagleaatale lfqnwvlvhddiedgseerrgrpalhrlhpmplalnagdamhaemwgllaeglarglfppevllefhev vrrtaygqhldllwtlggtfdlrpedyfrmvahkaayytavaplrlgallagktppaayeegglrlgta fqivddvlnleggeaygkeragdlyegkrtlillrfleeappeeraralallalpreakpeaevgwlle rllasralawakaeakrlqaeglalleaafqdlpgkealdhlrgllaalverra | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 1.55 | Rfree | 0.198 | | Matthews' coefficent | 2.46 | Rfactor | 0.175 | | Waters | 1187 | Solvent Content | 50.00 |
| Ligand Information | | Ligands | | | Metals | | | |
