| Title | Crystal structure of ATP-phosphoribosyltransferase(HisG). To be Published | | Site | RSGI | | PDB Id | | Target Id | ttk003000056.1 | | Molecular Characteristics | | Source | Thermus thermophilus | | Alias Ids | TPS14209, | Molecular Weight | 22379.89 Da. | | Residues | 206 | Isoelectric Point | 9.51 | | Sequence | mrrfaltvalpkgrmfreayevlkragldlpevegertllhgkeggvallelrnkdvpiyvdlgiaeig vvgkdvlldsgrdlfepvdlgfgacrlslirrpgdtgpirrvatkypnftarllkergwaadvvelsgn ielaavtgladavvdvvqtgatlraaglvevevlahstarlvvnrqalklkravlkpliqrlrelsgs | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.20 | Rfree | 0.247 | | Matthews' coefficent | 2.23 | Rfactor | 0.23 | | Waters | 242 | Solvent Content | 44.78 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 1;GOL (GLYCEROL) x 1 | | Metals | | | |
