| Title | Crystal Structure of the tRNA Processing Enzyme RNase PH from Aquifex aeolicus. J.Biol.Chem. 278 32397-32404 2003 | | Site | RSGI | | PDB Id | | Target Id | trt001000260.2 | | Molecular Characteristics | | Source | Aquifex aeolicus | | Alias Ids | TPS14122, | Molecular Weight | 28285.85 Da. | | Residues | 255 | Isoelectric Point | 5.31 | | Sequence | mrsdgrkedqlrpvsiqrdfleypegsclisfgktkvictasvienvpnwlkgkgqgwitaeysmlpra tqqrtiresvqgriggatheiqrmigramrtaveltkigertiwvdcdviqadggtrtaaitgafvava daiiklhkegiieetpikdfvaavsvgivndrilldlnfeedsaaqvdmnvvgtgsgrlsevhtmgeey sftkdelikmldlaqkginelielqkklyviqdgkwerselkevsstt | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.30 | Rfree | 0.26 | | Matthews' coefficent | 4.44 | Rfactor | 0.225 | | Waters | 89 | Solvent Content | 72.28 |
| Ligand Information | | Ligands | PO4 (PHOSPHATE) x 1;SO4 (SULFATE) x 2 | | Metals | | | |
