| Title | Crystal Structure of the tRNA Processing Enzyme RNase PH from Aquifex aeolicus. J.Biol.Chem. 278 32397-32404 2003 | | Site | RSGI | | PDB Id | | Target Id | trt001000260.1 | | Molecular Characteristics | | Source | Aquifex aeolicus | | Alias Ids | TPS14121, | Molecular Weight | 28370.96 Da. | | Residues | 255 | Isoelectric Point | 5.45 | | Sequence | mrsdgrkedqlrpvsiqrdfleypegsclisfgktkvictasvienvpnwlkgkgqgwitaeysmlpra tqqrtiresvqgriggrtheiqrmigramrtaveltkigertiwvdcdviqadggtrtaaitgafvava daiiklhkegiieetpikdfvaavsvgivndrilldlnfeedsaaqvdmnvvgtgsgrlsevhtmgeey sftkdelikmldlaqkginelielqkklyviqdgkwerselkevsstt | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.30 | Rfree | 0.275 | | Matthews' coefficent | 4.43 | Rfactor | 0.233 | | Waters | 100 | Solvent Content | 72.25 |
| Ligand Information | | Ligands | PO4 (PHOSPHATE) x 1;SO4 (SULFATE) x 2 | | Metals | | | |
