| Title | Specific Damage Induced by X-ray Radiation and Structural Changes in the Primary Photoreaction of Bacteriorhodopsin. J.Mol.Biol. 324 469-481 2002 | | Site | RSGI | | PDB Id | | Target Id | my_001000028.1 | | Molecular Characteristics | | Source | Halobacterium salinarum | | Alias Ids | TPS13698, | Molecular Weight | 26799.05 Da. | | Residues | 248 | Isoelectric Point | 4.83 | | Sequence | qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgygltmv pfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvgaltkvysyrfvww aistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsaypvvwligsegagivplnietll fmvldvsakvgfglillrsraifgeaeapepsagdgaaats | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.30 | Rfree | 0.275 | | Matthews' coefficent | 3.16 | Rfactor | 0.251 | | Waters | 41 | Solvent Content | 61.10 |
| Ligand Information | | Ligands | GLC-MAN-GAL (ALPHA-D-GLUCOSE) x 1;RET (ALPHA-D-MANNOSE) x 1;L3P (BETA-D-GALACTOSE) x 4;L2P (RETINAL) x 1 | | Metals | | | |
