| Title | The crystal structures of the ferric and ferrous forms of the heme complex of HmuO, a heme oxygenase of Corynebacterium diphtheriae. J.Biol.Chem. 279 11937-11947 2004 | | Site | RSGI | | PDB Id | | Target Id | my_001000032.2 | | Molecular Characteristics | | Source | Corynebacterium diphtheriae | | Alias Ids | TPS13707, | Molecular Weight | 24136.89 Da. | | Residues | 215 | Isoelectric Point | 5.38 | | Sequence | mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavrasgfa eslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalvahhyvrylgdls ggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlelsdeqrehllkeatdafvfnhqv fadlgkgl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 3 | | Resolution (Å) | 1.50 | Rfree | 0.202 | | Matthews' coefficent | 2.49 | Rfactor | 0.177 | | Waters | 584 | Solvent Content | 50.29 |
| Ligand Information | | Ligands | SUC (SUCROSE) x 1;SO4 (SULFATE) x 10;HEM (PROTOPORPHYRIN) x 3 | | Metals | | | |