| Title | Solution structure of the SEA domain from the murine homologue of ovarian cancer antigen CA125 (MUC16). J.Biol.Chem. 279 13174-13182 2004 | | Site | RSGI | | PDB Id | | Target Id | mmt007010579.1 | | Molecular Characteristics | | Source | Mus musculus | | Alias Ids | TPS13521, | Molecular Weight | 13660.48 Da. | | Residues | 119 | Isoelectric Point | 9.10 | | Sequence | ssssqhfnlnftitnlpysqdiaqpsttkyqqtkrsienalnqlfrnssiksyfsdcqvlafrsvsnnn nhtgvdslcnfsplarrvdrvaiyeeflrmthngtqllnftldrksvfvd | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
