| Title | Structure and catalytic mechanism of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (MECDP) synthase, an enzyme in the non-mevalonate pathway of isoprenoid synthesis. Acta Crystallogr.,Sect.D 59 23-31 2003 | | Site | RSGI | | PDB Id | | Target Id | ttk003001861.2 | | Molecular Characteristics | | Source | Thermus thermophilus | | Alias Ids | TPS14809, | Molecular Weight | 16519.08 Da. | | Residues | 152 | Isoelectric Point | 6.97 | | Sequence | mrigygedshrleegrplylcgllipspvgalahsdgdaalhaltdallsayglgdigllfpdtdprwr gersevflrealrlveargakllqaslvltldrpklgphrkalvdslsrllrlpqdrigltfktsegla pshvqaravvlldg | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 6 | | Resolution (Å) | 1.55 | Rfree | 0.249 | | Matthews' coefficent | 2.11 | Rfactor | 0.177 | | Waters | 509 | Solvent Content | 41.58 |
| Ligand Information | | Ligands | CDP (CYTIDINE-5'-DIPHOSPHATE) x 6 | | Metals | MG (MAGNESIUM) x 12 | | |