| Title | Solution structure of the YqgF-family protein (N-terminal fragment). To be published | | Site | RSGI | | PDB Id | | Target Id | ttk003001690.1 | | Molecular Characteristics | | Source | Thermus thermophilus | | Alias Ids | TPS14778, | Molecular Weight | 14892.53 Da. | | Residues | 135 | Isoelectric Point | 7.99 | | Sequence | mrvgaldvgeariglavgeegvplasgrgylvrktleedvealldfvrreglgklvvglplrtdlkesa qagkvlplvealrargvevelwderfttklaqerlkhapkrlrrdkgkldelaavvlledylargi | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
