| Title | Solution structure of DnaJ domain of human KIAA0730 protein. To be published | | Site | RSGI | | PDB Id | | Target Id | hsk001000009.1 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS12562, | Molecular Weight | 9079.89 Da. | | Residues | 75 | Isoelectric Point | 9.45 | | Sequence | ilkevtsvveqawklpeserkkiirrlylkwhpdknpenhdianevfkhlqneinrlekqafldqnadr asrrtf | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |