.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iuk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structure of a conserved CoA-binding protein synthesized by a cell-free system. Acta Crystallogr.,Sect.D 59 1213-1218 2003
    Site RSGI
    PDB Id 1iuk Target Id ttk003001466.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14727, Molecular Weight 15865.61 Da.
    Residues 140 Isoelectric Point 6.52
    Sequence mndqelraylsqaktiavlgahkdpsrpahyvprylreqgyrvlpvnprfqgeelfgeeavaslldlke pvdildvfrppsalmdhlpevlalrpglvwlqsgirhpefekalkeagipvvadrclmvehkrlfrgpl pl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.284
    Matthews' coefficent 1.93 Rfactor 0.22
    Waters 85 Solvent Content 35.67

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch