| Title | Crystal structure of the conserved hypothetical protein TT1380 from Thermus thermophilus HB8. Proteins 55 778-780 2004 | | Site | RSGI | | PDB Id | | Target Id | ttk003001380.1 | | Molecular Characteristics | | Source | Thermus thermophilus | | Alias Ids | TPS14710, | Molecular Weight | 12256.31 Da. | | Residues | 106 | Isoelectric Point | 5.48 | | Sequence | mfvtmnripvrpeyaeqfeeafrqrarlvdrmpgfirnlvlrpknpgdpyvvmtlweseeafrawtesp afkegharsgtlpkeaflgpnrleafevvldsegrdg | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.60 | Rfree | 0.26408 | | Matthews' coefficent | 1.65 | Rfactor | 0.23335 | | Waters | 61 | Solvent Content | 25.30 |
| Ligand Information | | Ligands | | | Metals | ZN (ZINC) x 7 | | |
