| Title | Crystal Structure of the 2'-5' RNA Ligase from Thermus thermophilus HB8. J.MOL.BIOL. 329 903-911 2003 | | Site | RSGI | | PDB Id | | Target Id | ttk003000787.1 | | Molecular Characteristics | | Source | Thermus thermophilus | | Alias Ids | TPS14436, | Molecular Weight | 22409.74 Da. | | Residues | 198 | Isoelectric Point | 9.25 | | Sequence | mrlfyavflpeevraalveaqtkvrpfrgwkpvpphqlhltllflgerpeeelpdylalghrlarleap frarlrgtgyfpnegtprvwfakaeaegflrlaeglragveellgeeavripgwdkpfkphitlarrka paprvppvlfglewpvegfalvrselkpkgpvytvlekfslrgehgreqaqgpgerpegd | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.50 | Rfree | 0.271 | | Matthews' coefficent | 2.56 | Rfactor | 0.198 | | Waters | 74 | Solvent Content | 51.91 |
| Ligand Information | | Ligands | | | Metals | | | |
