| Title | Solution structure determination of the two DNA-binding domains in the Schizosaccharomyces pombe Abp1 protein by a combination of dipolar coupling and diffusion anisotropy restraints. J.Biomol.NMR 22 333-347 2002 | | Site | RSGI | | PDB Id | | Target Id | my_001000008.1 | | Molecular Characteristics | | Source | Schizosaccharomyces pombe | | Alias Ids | TPS13668, | Molecular Weight | 17056.57 Da. | | Residues | 144 | Isoelectric Point | 9.62 | | Sequence | gihmgkikrraitehekralrhyffqlqnrsgqqdliewfrekfgkdisqpsvsqilsskysyldntve kpwdvkrnrppkyplleaalfewqvqqgddatlsgetikraaailwhkipeyqdqpvpnfsngwlegfr krhilh | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
