.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iub

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal Structure of Fucose-Specific Lectin from Aleuria aurantia Binding Ligands at Three of Its Five Sugar Recognition Sites. Biochemistry 42 11093-11099 2003
    Site RSGI
    PDB Id 1iub Target Id my_001000040.2
    Molecular Characteristics
    Source Aleuria aurantia
    Alias Ids TPS13717, Molecular Weight 33396.40 Da.
    Residues 312 Isoelectric Point 9.33
    Sequence pteflytskiaaiswaatggrqqrvyfqdlngkireaqrggdnpwtggssqnvigeaklfsplaavtwk saqgiqirvycvnkdnilsefvydgskwitgqlgsvgvkvgsnsklaalqwggsesappnirvyyqksn gsgssiheyvwsgkwtagasfgstvpgtgigataigpgrlriyyqatdnkirehcwdsnswyvggfsas asagvsiaaiswgstpnirvywqkgreelyeaayggswntpgqikdasrptpslpdtfiaanssgnidi svffqasgvslqqwqwisgkgwsigavvptgtpagw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.31 Rfree 0.183
    Matthews' coefficent 3.86 Rfactor 0.156
    Waters 114 Solvent Content 68.15

    Ligand Information
    Ligands FUL (BETA-L-FUCOSE) x 2;SO4 (SULFATE) x 1
    Metals HG (MERCURY) x 2;CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch