.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iu3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structural and biochemical analyses of hemimethylated DNA binding by the SeqA protein. Nucleic Acids Res. 32 82-92 2004
    Site RSGI
    PDB Id 1iu3 Target Id trt001000146.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS14085, Molecular Weight 13020.27 Da.
    Residues 116 Isoelectric Point 7.02
    Sequence gplgsamrelllsdeyaeqkravnrfmlllstlysldaqafaeateslhgrtrvyfaadeqtllkngnq tkpkhvpgtpywvitntntgrkcsmiehimqsmqfpaeliekvcgti
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.00 Rfree 0.286
    Matthews' coefficent Rfactor 0.238
    Waters 131 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch