| Title | Structural and biochemical analyses of hemimethylated DNA binding by the SeqA protein. Nucleic Acids Res. 32 82-92 2004 | | Site | RSGI | | PDB Id | | Target Id | trt001000146.1 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS14085, | Molecular Weight | 13020.27 Da. | | Residues | 116 | Isoelectric Point | 7.02 | | Sequence | gplgsamrelllsdeyaeqkravnrfmlllstlysldaqafaeateslhgrtrvyfaadeqtllkngnq tkpkhvpgtpywvitntntgrkcsmiehimqsmqfpaeliekvcgti | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 3.00 | Rfree | 0.286 | | Matthews' coefficent | | Rfactor | 0.238 | | Waters | 131 | Solvent Content | |
| Ligand Information | | Ligands | | | Metals | | | |
