| Title | Solution structure of a telomeric DNA complex of human TRF1. Structure 9 1237-1251 2001 | | Site | RSGI | | PDB Id | | Target Id | my_001000018.1 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS13681, | Molecular Weight | 8447.30 Da. | | Residues | 69 | Isoelectric Point | 10.28 | | Sequence | tpekhrarkrqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkklklissdsed | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |