| Title | Solution structure of the Eps15 homology domain of a human POB1 (partner of RalBP1). FEBS Lett. 442 138-142 1999 | | Site | RSGI | | PDB Id | | Target Id | trt001000213.1 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS14106, | Molecular Weight | 12432.17 Da. | | Residues | 110 | Isoelectric Point | 4.45 | | Sequence | gslqdnssypdepwriteeqreyyvnqfrslqpdpssfisgsvaknfftksklsipelsyiwelsdadc dgaltlpefcaafhlivarkngyplpeglpptlqpefivtd | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | CA (CALCIUM) x 1 | | |
