| Title | Crystal structure of the CENP-B protein-DNA complex: the DNA-binding domains of CENP-B induce kinks in the CENP-B box DNA. EMBO J. 20 6612-6618 2001 | | Site | RSGI | | PDB Id | | Target Id | trt001000209.1 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS14102, | Molecular Weight | 15139.82 Da. | | Residues | 131 | Isoelectric Point | 10.63 | | Sequence | mgpkrrqltfreksriiqeveenpdlrkgeiarrfnippstlstilknkrailaserkygvastcrktn klspydkleglliawfqqiraaglpvkgiilkekalriaeelgmddftasngwldrfrrrrs | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.50 | Rfree | 0.2599000 | | Matthews' coefficent | 4.88 | Rfactor | 0.2219000 | | Waters | 98 | Solvent Content | 74.80 |
| Ligand Information | | Ligands | | | Metals | | | |
