| Title | The crystal structure of the bacteria-specific L17 ribosomal protein from Thermus thermophilus. To be Published | | Site | RSGI | | PDB Id | | Target Id | ttk003000817.1 | | Molecular Characteristics | | Source | Thermus thermophilus | | Alias Ids | TPS14446, | Molecular Weight | 13714.32 Da. | | Residues | 118 | Isoelectric Point | 11.36 | | Sequence | mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrd lqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 9 | | Resolution (Å) | 2.30 | Rfree | 0.2540000 | | Matthews' coefficent | 3.11 | Rfactor | 0.2100000 | | Waters | 157 | Solvent Content | 60.39 |
| Ligand Information | | Ligands | | | Metals | | | |
