| Title | The crystal structure of the ttCsaA protein: an export-related chaperone from Thermus thermophilus. EMBO J. 20 562-569 2001 | | Site | RSGI | | PDB Id | | Target Id | ttk003000895.1 | | Molecular Characteristics | | Source | Thermus thermophilus | | Alias Ids | TPS14480, | Molecular Weight | 11898.37 Da. | | Residues | 109 | Isoelectric Point | 8.89 | | Sequence | mtpleafqildlrvgrvlraephekarkpsyklwvdlgplgvkqssaqitelyrpedlvgrlvvcavnl gakrvagflsevlvlgvpdeagrvvllapdrevplggkvf | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.00 | Rfree | 0.2770000 | | Matthews' coefficent | 2.72 | Rfactor | 0.2170000 | | Waters | 328 | Solvent Content | 54.75 |
| Ligand Information | | Ligands | | | Metals | | | |
