| Title | Solution structure of the human parvulin-like peptidyl prolyl cis/trans isomerase, hPar14. J.Mol.Biol. 305 917-926 2001 | | Site | RSGI | | PDB Id | | Target Id | nhs001015441.1 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS13755, | Molecular Weight | 11166.49 Da. | | Residues | 102 | Isoelectric Point | 9.52 | | Sequence | gpkgggnavkvrhilcekhgkimeameklksgmrfnevaaqysedkarqggdlgwmtrgsmvgpfqeaa falpvsgmdkpvftdppvktkfgyhiimvegrk | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
