| Title | NMR structure of the hRap1 Myb motif reveals a canonical three-helix bundle lacking the positive surface charge typical of Myb DNA-binding domains. J.Mol.Biol. 312 167-175 2001 | | Site | RSGI | | PDB Id | | Target Id | trt001000207.1 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS14101, | Molecular Weight | 6649.15 Da. | | Residues | 59 | Isoelectric Point | 9.60 | | Sequence | griaftdaddvailtyvkenarspssvtgnalwkamekssltqhswqslkdrylkhlrg | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
