| Title | Solution structure of the Ras-binding domain of RGL. FEBS Lett. 441 413-418 1998 | | Site | RSGI | | PDB Id | | Target Id | trt001000187.1 | | Molecular Characteristics | | Source | Mus musculus | | Alias Ids | TPS14093, | Molecular Weight | 11726.59 Da. | | Residues | 103 | Isoelectric Point | 4.59 | | Sequence | sitstvlppvynqqnedtciirisvednngnmyksimltsqdktpaviqramskhnlesdpaeeyelvq visedkelvipdsanvfyamnsqvnfdfilrkkn | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
