| Title | Crystal structure of a repair enzyme of oxidatively damaged DNA, MutM (Fpg), from an extreme thermophile, Thermus thermophilus HB8. EMBO J. 19 3857-3869 2000 | | Site | RSGI | | PDB Id | | Target Id | ttk003000730.1 | | Molecular Characteristics | | Source | Thermus thermophilus | | Alias Ids | TPS14422, | Molecular Weight | 29913.78 Da. | | Residues | 267 | Isoelectric Point | 10.27 | | Sequence | mpelpevettrrrlrplvlgqtlrqvvhrdparyrntalaegrrilevdrrgkfllfaleggvelvahl gmtggfrleptphtraalvlegrtlyfhdprrfgrlfgvrrgdyreiplllrlgpeplseafafpgffr glkesarplkallldqrlaagvgniyadealfrarlspfrparslteeearrlyralrevlaeavelgg stlsdqsyrqpdglpggfqtrhavygreglpcpacgrpverrvvagrgthfcptcqgegp | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.90 | Rfree | 0.2580000 | | Matthews' coefficent | 2.24 | Rfactor | 0.2140000 | | Waters | 292 | Solvent Content | 45.11 |
| Ligand Information | | Ligands | | | Metals | ZN (ZINC) x 2 | | |