| Title | NMR studies on functional structures of the AU-rich element-binding domains of Hu antigen C. Nucleic Acids Res. 28 1743-1750 2000 | | Site | RSGI | | PDB Id | | Target Id | trt001000186.1 | | Molecular Characteristics | | Source | Mus musculus | | Alias Ids | TPS14092, | Molecular Weight | 9340.19 Da. | | Residues | 85 | Isoelectric Point | 9.16 | | Sequence | danlyvsglpktmsqkemeqlfsqygriitsrilldqatgvsrgvgfirfdkrieaeeaikglngqkpl gaaepitvkfannpsq | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
