| Title | Structure of the central core domain of TFIIEbeta with a novel double-stranded DNA-binding surface. EMBO J. 19 1346-1356 2000 | | Site | RSGI | | PDB Id | | Target Id | trt001000206.1 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS14100, | Molecular Weight | 9272.25 Da. | | Residues | 81 | Isoelectric Point | 9.26 | | Sequence | alsgssgykfgvlakivnymktrhqrgdthpltldeildetqhldiglkqkqwlmtealvnnpkievid gkyafkpkynvr | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |