.
The Open Protein Structure Annotation Network
PDB Keyword
.

1bjw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structure of Thermus thermophilus HB8 aspartate aminotransferase and its complex with maleate. Biochemistry 38 2413-2424 1999
    Site RSGI
    PDB Id 1bjw Target Id ttk003000021.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14163, Molecular Weight 42048.70 Da.
    Residues 385 Isoelectric Point 6.00
    Sequence mrglsrrvqamkpsatvavnakalelrrqgvdlvaltagepdfdtpehvkeaarralaqgktkyappag ipelrealaekfrrenglsvtpeetivtvggkqalfnlfqaildpgdevivlspywvsypemvrfaggv vvevetlpeegfvpdpervrraitprtkalvvnspnnptgavypkevlealarlavehdfylvsdeiye hllyegehfspgrvapehtltvngaakafamtgwrigyacgpkevikamasvssqsttspdtiaqwatl ealtnqeasrafvemareayrrrrdlllegltalglkavrpsgafyvlmdtspiapdevraaerlleag vavvpgtdfaafghvrlsyatseenlrkalerfarvlgra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.2690000
    Matthews' coefficent 2.57 Rfactor 0.2150000
    Waters 308 Solvent Content 52.55

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch