| Title | Structure of Thermus thermophilus HB8 aspartate aminotransferase and its complex with maleate. Biochemistry 38 2413-2424 1999 | | Site | RSGI | | PDB Id | | Target Id | ttk003000021.1 | | Molecular Characteristics | | Source | Thermus thermophilus | | Alias Ids | TPS14163, | Molecular Weight | 42048.70 Da. | | Residues | 385 | Isoelectric Point | 6.00 | | Sequence | mrglsrrvqamkpsatvavnakalelrrqgvdlvaltagepdfdtpehvkeaarralaqgktkyappag ipelrealaekfrrenglsvtpeetivtvggkqalfnlfqaildpgdevivlspywvsypemvrfaggv vvevetlpeegfvpdpervrraitprtkalvvnspnnptgavypkevlealarlavehdfylvsdeiye hllyegehfspgrvapehtltvngaakafamtgwrigyacgpkevikamasvssqsttspdtiaqwatl ealtnqeasrafvemareayrrrrdlllegltalglkavrpsgafyvlmdtspiapdevraaerlleag vavvpgtdfaafghvrlsyatseenlrkalerfarvlgra | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.80 | Rfree | 0.2690000 | | Matthews' coefficent | 2.57 | Rfactor | 0.2150000 | | Waters | 308 | Solvent Content | 52.55 |
| Ligand Information | | Ligands | PO4 (PHOSPHATE) x 2 | | Metals | | | |
